PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004505405.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 234aa    MW: 26975.4 Da    PI: 10.1211
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004505405.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.72.6e-171050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i n+s r+ tf kR++g++KK +ELS+LC+++++ ii+s+
  XP_004505405.1 10 FITNDSARKATFKKRKKGLIKKVSELSTLCGIDACAIIYSP 50
                    89**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.834149IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-24160IPR002100Transcription factor, MADS-box
CDDcd002663.96E-22285No hitNo description
SuperFamilySSF554553.66E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-181051IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MTRKKVKLAF ITNDSARKAT FKKRKKGLIK KVSELSTLCG IDACAIIYSP YDLQPEIWPS  60
PLGVQKVLTK FQRMPELEQS KKMVNQESFL KQRIQKAKDQ LSKQRKDNRE KEMTHLMFQN  120
LSAGKIMPNI SMVDLNDMAW LIDQYLKEIN RRVETLVKNS QGQAQLAPLP MVTNIGMTKI  180
EEKAQGSHGH VLDMNMDVMQ KQHWFMNLLD DDGDTPPLGD VSHQNGFWPN SFFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFITNDSARKATFKKRK
22125KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505405.11e-176PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK39e-65AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV7D1F91e-122V7D1F9_PHAVU; Uncharacterized protein
STRINGGLYMA18G04760.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-66AGAMOUS-like 80